PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009789076.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 587aa    MW: 64246.4 Da    PI: 4.762
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009789076.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.55.2e-1382195841374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAea+++++++la+alL+++  la +++ +m+++a+yf+eALa++++r    ly    ps+ ++   ++ l++   f+e++P+lkf+h
  XP_009789076.1 219 LVHTLMACAEAIQQEKMKLAEALLKQIGFLAVSQAGAMRKVATYFAEALARKVYR----LY----PSNPNDPAFTDLLQM--HFYETCPYLKFAH 303
                     689****************************************************....44....444443334555444..5************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIlea+++++++H+iDf+++qG+QWpaLlqaLa Rp+g+p++R+Tg+g+p++++++ l+++g++La++Ae+++v+fef+ +va++l+dl+
  XP_009789076.1 304 FTANQAILEAFANKNKIHVIDFSMKQGMQWPALLQALALRPGGAPTFRLTGIGPPSQDNTDHLQQVGWKLAQLAESINVEFEFRGFVANTLADLD 398
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak.....lprese 280
                      +++++++gE++aVn++++lh+ll++++ +e+    vL++vk+l+P+++++veqea+hn++ F++rf+e+l+yys+lfdsle       l++ s+
  XP_009789076.1 399 ASMFDIREGETVAVNSMFELHQLLARPGGIEK----VLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCgsggeLGPVSD 489
                     *******************************9....*********************************************8766677799999* PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++ +++++lgr+i+n+v+ceg +r+erhetl++Wr r+++aGF+pv+l+++a kqa++ll+ ++ + gy+vee++g+l+lgW++rpL+++SaW+
  XP_009789076.1 490 QDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVHLGSNAFKQASMLLALFAgGGGYKVEENNGCLMLGWHTRPLIATSAWK 584
                     *****************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576129No hitNo description
PfamPF120412.1E-3444110IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.3E-3344117No hitNo description
PROSITE profilePS5098566.546193563IPR005202Transcription factor GRAS
PfamPF035141.8E-135219584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MKRGHTMPYE QLEDSFSGGC SSAAGGGGCS GKGKMWEEDG GVDDELLAVL GYKVKASDMA  60
EVAQKLEQLE EVMGSVEQDN LSFLASETVH YNPSDLSSWL ESMISELNPQ DPFSNSSSSF  120
PTNQVYEDSS SFDSDLTAIP GKAVFPQIEN PAHEPQVQQP QSKRFKPTTA TELSSSSSSS  180
ISVGGGMWGS FQSESISTRP AESTRPVVLV DSQGNGVRLV HTLMACAEAI QQEKMKLAEA  240
LLKQIGFLAV SQAGAMRKVA TYFAEALARK VYRLYPSNPN DPAFTDLLQM HFYETCPYLK  300
FAHFTANQAI LEAFANKNKI HVIDFSMKQG MQWPALLQAL ALRPGGAPTF RLTGIGPPSQ  360
DNTDHLQQVG WKLAQLAESI NVEFEFRGFV ANTLADLDAS MFDIREGETV AVNSMFELHQ  420
LLARPGGIEK VLSFVKDLKP EIFTIVEQEA NHNGPVFMDR FTESLHYYST LFDSLEGCGS  480
GGELGPVSDQ DKLMSEVYLG RQICNLVSCE GVDRVERHET LAQWRTRFNS AGFEPVHLGS  540
NAFKQASMLL ALFAGGGGYK VEENNGCLML GWHTRPLIAT SAWKLSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-562195844375GRAS family transcription factor containing p
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789076.10.0PREDICTED: DELLA protein GAI1-like
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLA0A0U4I5310.0A0A0U4I531_CAPAN; Putative DELLA protein GAI
STRINGVIT_01s0011g05260.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21262462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein